Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF1 Rabbit Polyclonal Antibody (HRP)

RASSF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

123F2, RDA32, NORE2A, RASSF1A, REH3P21

UniProt

Q9NS23

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RASSF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQIL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733831

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPACUNK4.20 Antibody
orb856889 2 mg

SPACUNK4.20 Antibody

Sign In for Pricing
View Details
Human anti-cell membrane DNA antibody, cmDNA ELISA Kit
MBS7253888-01 48 Well

Human anti-cell membrane DNA antibody, cmDNA ELISA Kit

Sign In for Pricing
View Details
Human anti-cell membrane DNA antibody, cmDNA ELISA Kit
MBS7253888-02 96 Well

Human anti-cell membrane DNA antibody, cmDNA ELISA Kit

Sign In for Pricing
View Details
Human anti-cell membrane DNA antibody, cmDNA ELISA Kit
MBS7253888-03 5x 96 Well

Human anti-cell membrane DNA antibody, cmDNA ELISA Kit

Sign In for Pricing
View Details
Human anti-cell membrane DNA antibody, cmDNA ELISA Kit
MBS7253888-04 10x 96 Well

Human anti-cell membrane DNA antibody, cmDNA ELISA Kit

Sign In for Pricing
View Details
NDUFA4 Antibody
orb2677004-01 50 µL

NDUFA4 Antibody

Sign In for Pricing
View Details