Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90ab1 Peptide - N-terminal region

Hsp90ab1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

90kDa, AL022974, C81438, Hsp84, Hsp84-1, Hsp90, Hspcb, MGC115780

UniProt

P11499

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsp90ab1 Rabbit Polyclonal Antibody (orb584136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032328

Preservative

Lyophilized powder

AA Sequence

NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motexafin gadolinium
T33487 25 mg

Motexafin gadolinium

Sign In for Pricing
View Details
500 mL Single-Use Storage Bottle (NG)
BIOBGBTB500ML009 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

500 mL Single-Use Storage Bottle (NG)

Sign In for Pricing
View Details
Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)
orb1184438-01 25 Tests

Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)
orb1184438-02 50 Tests

Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)
orb1184438-03 100 Tests

Human CD103 (ITGAE) Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
NF-KB p65 (acetyl K314/K315) Antibody
KC-4462-01 50 μL

NF-KB p65 (acetyl K314/K315) Antibody

Sign In for Pricing
View Details