Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc6 Peptide - N-terminal region

Ccdc6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810012H18Rik, AA536681, AA960498, AW061011

UniProt

D3YZP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccdc6 Rabbit Polyclonal Antibody (orb585163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104591

Preservative

Lyophilized powder

AA Sequence

LASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT2 Human shRNA Plasmid Kit (Locus ID 22933)
TL301692 1 Kit

SIRT2 Human shRNA Plasmid Kit (Locus ID 22933)

Sign In for Pricing
View Details
Olfr883 AAV Vector (Mouse) (CMV)
33515104 1 µg

Olfr883 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
J208
HY-163535 1 Each

J208

Sign In for Pricing
View Details
WDR22 AAV siRNA Pooled Vector
50312161 1.0 µg

WDR22 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
AF10 (mLLT10) Human shRNA Plasmid Kit (Locus ID 8028)
TL311459 1 Kit

AF10 (mLLT10) Human shRNA Plasmid Kit (Locus ID 8028)

Sign In for Pricing
View Details
Ulex europaeus, Crude (UEA I, UEA II, Gorze, Furze)
U1500-51 1 mg

Ulex europaeus, Crude (UEA I, UEA II, Gorze, Furze)

Sign In for Pricing
View Details