Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQOR Peptide - C-terminal region

SQOR Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sqrdl, 0610039J17Rik, 4930557M22Rik

UniProt

Q9R112

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SQOR Rabbit Polyclonal Antibody (orb585405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067482

Preservative

Lyophilized powder

AA Sequence

AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Protein SUR7 (SUR7), partial
MBS7061274 Inquire

Recombinant Saccharomyces cerevisiae Protein SUR7 (SUR7), partial

Sign In for Pricing
View Details
Human INPP1 Pre-designed siRNA Set B
SI007680B 1 Each

Human INPP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (AP) discontinued
123342-AP 100 µL

ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (AP) discontinued

Sign In for Pricing
View Details
2,3-Dideoxyuridine (ddU) extrapure, 98%
17412-01 25 mg

2,3-Dideoxyuridine (ddU) extrapure, 98%

Sign In for Pricing
View Details
2,3-Dideoxyuridine (ddU) extrapure, 98%
17412-02 100 mg

2,3-Dideoxyuridine (ddU) extrapure, 98%

Sign In for Pricing
View Details
Rabbit Anti ATAD3B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul
IRBAMLATAD3BAP541200UL 200 µL

Rabbit Anti ATAD3B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence) 200ul

Sign In for Pricing
View Details