Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angpt1 Peptide - C-terminal region

Angpt1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110046O21Rik, Ang-1, Ang1

UniProt

Q8C2K6

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Angpt1 Rabbit Polyclonal Antibody (orb585529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033770

Preservative

Lyophilized powder

AA Sequence

EFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPGR Antibody (C-term)
orb1937647-01 50 µL

RPGR Antibody (C-term)

Sign In for Pricing
View Details
RPGR Antibody (C-term)
orb1937647-02 100 µL

RPGR Antibody (C-term)

Sign In for Pricing
View Details
ADRM1 Peptide - N-terminal region
orb2006092 100 µg

ADRM1 Peptide - N-terminal region

Sign In for Pricing
View Details
Plastin L Recombinant Antibody, Cy5 Conjugated
bsm-62866R-Cy5-01 20 µL

Plastin L Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Plastin L Recombinant Antibody, Cy5 Conjugated
bsm-62866R-Cy5-02 100 µL

Plastin L Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
TGFB1I1 Protein (N-His, Human)
P509002 100 µg

TGFB1I1 Protein (N-His, Human)

Sign In for Pricing
View Details