Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRM1 Peptide - N-terminal region

ADRM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARM1, GP110, Rpn13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRM1 Rabbit Polyclonal Antibody (orb331038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q16186

Preservative

Lyophilized powder

AA Sequence

PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TEM8/ANTXR1 Antibody (200C1339(SB20)) - Azide Free
NBP2-33232 0.1 mg

Mouse Monoclonal TEM8/ANTXR1 Antibody (200C1339(SB20)) - Azide Free

Sign In for Pricing
View Details
HDAC6 Knockout Hela Polyclonal Cells
ARG37533 1 Million

HDAC6 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
RAB1B Antibody (FITC)
abx315507-01 20 µg

RAB1B Antibody (FITC)

Sign In for Pricing
View Details
RAB1B Antibody (FITC)
abx315507-02 50 µg

RAB1B Antibody (FITC)

Sign In for Pricing
View Details
RAB1B Antibody (FITC)
abx315507-03 100 µg

RAB1B Antibody (FITC)

Sign In for Pricing
View Details
RAB1B Antibody (FITC)
abx315507-04 200 µg

RAB1B Antibody (FITC)

Sign In for Pricing
View Details