Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOE Peptide - N-terminal region

APOE Peptide - N-terminal region

Product Specifications

Product Name Alternative

AD2, LDLCQ5, LPG, MGC1571

UniProt

P02649

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOE Rabbit Polyclonal Antibody (orb333723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_000032

Preservative

Lyophilized powder

AA Sequence

LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D730048I06Rik (NM_026593) Mouse Tagged ORF Clone
MG200371 10 µg

D730048I06Rik (NM_026593) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LGR6 Antibody
8G376-AAT 50 µg

LGR6 Antibody

Sign In for Pricing
View Details
alpha 2b Adrenergic Receptor (ADRA2B) Human Gene Knockout Kit (CRISPR)
KN420659 1 Kit

alpha 2b Adrenergic Receptor (ADRA2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human ALK-1/ACVRL1 Protein (Fc Tag)
PKSH033782-01 10 µg

Recombinant Human ALK-1/ACVRL1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ALK-1/ACVRL1 Protein (Fc Tag)
PKSH033782-02 50 µg

Recombinant Human ALK-1/ACVRL1 Protein (Fc Tag)

Sign In for Pricing
View Details
Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate
LY431248 100 µg

Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate

Sign In for Pricing
View Details