Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - N-terminal region

CCKAR Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1-R, CCKRA

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb331266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000721

Preservative

Lyophilized powder

AA Sequence

GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated
orb3008435-01 20 µg

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated
orb3008435-02 100 µg

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated
orb3008435-03 1 mg

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

Sign In for Pricing
View Details
Ethyl (E) -3-[4- (4-bromophenyl) phenyl]prop-2-enoate
OR310302 1 Each

Ethyl (E) -3-[4- (4-bromophenyl) phenyl]prop-2-enoate

Sign In for Pricing
View Details
Growth-Regulated Alpha Protein / GROA (CXCL1) Antibody (Biotin)
abx272643-01 200 µL

Growth-Regulated Alpha Protein / GROA (CXCL1) Antibody (Biotin)

Sign In for Pricing
View Details
Growth-Regulated Alpha Protein / GROA (CXCL1) Antibody (Biotin)
abx272643-02 1 mL

Growth-Regulated Alpha Protein / GROA (CXCL1) Antibody (Biotin)

Sign In for Pricing
View Details