Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal S100A7A Antibody
NBP3-05915-100ul 100 µL

Rabbit Polyclonal S100A7A Antibody

Sign In for Pricing
View Details
H-Arg-Lys-OH TFA
MBS5815952 Inquire

H-Arg-Lys-OH TFA

Sign In for Pricing
View Details
PATHfinder - Real-Time PCR kit for the detection of foodborne Giardia
PMB41A-50 1 Each

PATHfinder - Real-Time PCR kit for the detection of foodborne Giardia

Sign In for Pricing
View Details
OST-beta Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-42194R-BF405 100 µL

OST-beta Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant AM-Tag Antibody
B2016944 5 µg

Recombinant AM-Tag Antibody

Sign In for Pricing
View Details
MAP2 Antibody
A24093-50UG 50 µg

MAP2 Antibody

Sign In for Pricing
View Details