Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1 Peptide - C-terminal region

RCN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ37041, PIG20, RCAL, RCN

UniProt

Q15293

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCN1 Rabbit Polyclonal Antibody (orb326495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002892

Preservative

Lyophilized powder

AA Sequence

QAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEC1 Rabbit mAb
E60M2377 100 µL

HEC1 Rabbit mAb

Sign In for Pricing
View Details
Mouse Superoxide Dismutase 3, Extracellular (SOD3) ELISA Kit
DLR-SOD3-Mu-96T 96 Tests

Mouse Superoxide Dismutase 3, Extracellular (SOD3) ELISA Kit

Sign In for Pricing
View Details
S100B Polyclonal Antibody, HRP Conjugated
bs-2015R-HRP-01 20 µL

S100B Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
S100B Polyclonal Antibody, HRP Conjugated
bs-2015R-HRP-02 100 µL

S100B Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
HLA-DQB1 Protein, Human, Recombinant (His)
TMPH-01495-01 5 µg

HLA-DQB1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
HLA-DQB1 Protein, Human, Recombinant (His)
TMPH-01495-02 10 µg

HLA-DQB1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details