IL26 Peptide - N-terminal region
IL26 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AK155, IL-26
UniProt
Q9NPH9
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL26 Rabbit Polyclonal Antibody (orb586073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060872
Preservative
Lyophilized powder
AA Sequence
LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401922-100 1x 100 µL
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH030315 50 µg
Recombinant Human SPHK1/Sphingosine Kinase 1 Protein
Sign In for Pricing
View Details 
TRC-T771895-250MG 250 mg
5,6-Tribromo-3b-hydroxy-16-pregnen-20-one Acetate
Sign In for Pricing
View Details 
