Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYI Peptide - N-terminal region

HYI Peptide - N-terminal region

Product Specifications

Product Name Alternative

HT036, MGC20767

UniProt

Q5T013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HYI Rabbit Polyclonal Antibody (orb585974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112484

Preservative

Lyophilized powder

AA Sequence

AGLRLVLINTPPGDQEKGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: LBI6F8]
AMM20370VCF 100 µg

IL20 Receptor alpha (IL20RA) Mouse Monoclonal Antibody [Clone ID: LBI6F8]

Sign In for Pricing
View Details
Gevokizumab (Anti-IL-1b)
C00631-1mg 1 mg

Gevokizumab (Anti-IL-1b)

Sign In for Pricing
View Details
Smcr8 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4542103 1.0 µg DNA

Smcr8 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse infectious laryngotracheitis antibody (ILT Ab) ELISA Kit
EIA07252m 1 Kit

Mouse infectious laryngotracheitis antibody (ILT Ab) ELISA Kit

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)
orb2920697-01 20 µg

Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)

Sign In for Pricing
View Details
Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)
orb2920697-02 100 µg

Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)

Sign In for Pricing
View Details