Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)

This Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1189

UniProt

Q9CLN1

Expression Region

1-156

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEKRLAQISVVLSTIIIMTYAFLSSYFLNKPLNLSSADLMYFALSNLLSLSLPFVCAWF PYLFVRPAAVTGSALSAFGLFLFFAITSSTMDDPKGAAAIWVIYFFWLIGAALAGVYPAL FKPHFFTKTATRALVLSALFTVVVSFIIGFLISRIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0065608 1.0 µg DNA

AKAP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GATSL2 Protein Vector (Mouse) (pPM-C-HA)
21340024 500 ng

GATSL2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human PASK Protein - (Dry Ice)
H00023178-Q01-25ug 25 µg

Recombinant Human PASK Protein - (Dry Ice)

Sign In for Pricing
View Details
AP3B1 Antibody
A12790-50UL 50 μL

AP3B1 Antibody

Sign In for Pricing
View Details
S17A5 rabbit pAb
E44H13457 100 µL

S17A5 rabbit pAb

Sign In for Pricing
View Details
Mouse MMP-3 ELISA Kit
orb1086288 96 Tests

Mouse MMP-3 ELISA Kit

Sign In for Pricing
View Details