Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Peptide - C-terminal region

AMPD3 Peptide - C-terminal region

Product Specifications

UniProt

B7Z2S2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMPD3 Rabbit Polyclonal Antibody (orb586051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165902

Preservative

Lyophilized powder

AA Sequence

LQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 350 Anti-mouse CD105 Antibody *MJ7/18*
11050011-AAT 500 Tests

IFluor® 350 Anti-mouse CD105 Antibody *MJ7/18*

Sign In for Pricing
View Details
Anti-Human MOP4 antiserum # 1
MOP41-S 100 µL

Anti-Human MOP4 antiserum # 1

Sign In for Pricing
View Details
8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-Biotin
NU-811-BIO 50 μL

8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-Biotin

Sign In for Pricing
View Details
Leptin Recombinant Protein
500-058 500 µg

Leptin Recombinant Protein

Sign In for Pricing
View Details
Xamoterol hemifumarate
MBS3605794-01 5 mg

Xamoterol hemifumarate

Sign In for Pricing
View Details
Xamoterol hemifumarate
MBS3605794-02 10 mg

Xamoterol hemifumarate

Sign In for Pricing
View Details