Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDSP1 Peptide - N-terminal region

CTDSP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NLIIF, SCP1, NIF3, NLI-IF

UniProt

Q9GZU7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTDSP1 Rabbit Polyclonal Antibody (orb331303) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067021

Preservative

Lyophilized powder

AA Sequence

KGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL6A2 Polyclonal Antibody
MBS9433618-01 0.05 mL

COL6A2 Polyclonal Antibody

Sign In for Pricing
View Details
COL6A2 Polyclonal Antibody
MBS9433618-02 0.1 mL

COL6A2 Polyclonal Antibody

Sign In for Pricing
View Details
COL6A2 Polyclonal Antibody
MBS9433618-03 5x 0.1 mL

COL6A2 Polyclonal Antibody

Sign In for Pricing
View Details
Fam78a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3585706 1.0 µg DNA

Fam78a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (MaxLight 405) discontinued
125313-ML405 100 µL

CREB3 (LZIP, Cyclic AMP-responsive Element-binding Protein 3, Leucin Zipper Proitein, Luman, Transcription Factor LZIP-alpha, Processed Cyclic AMP-responsive Element-binding Protein 3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PCPA methyl ester (hydrochloride) (Standard)
HY-101456R 1 Each

PCPA methyl ester (hydrochloride) (Standard)

Sign In for Pricing
View Details