Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - C-terminal region

BIN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC14978

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BIN3 Rabbit Polyclonal Antibody (orb586161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061158

Preservative

Lyophilized powder

AA Sequence

LDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG5 Human Gene Knockout Kit (CRISPR)
KN418776 1 Kit

ABCG5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Calumenin Protein (aa 20-315, His Tag)
PKSH033293-01 10 µg

Recombinant Human Calumenin Protein (aa 20-315, His Tag)

Sign In for Pricing
View Details
Recombinant Human Calumenin Protein (aa 20-315, His Tag)
PKSH033293-02 50 µg

Recombinant Human Calumenin Protein (aa 20-315, His Tag)

Sign In for Pricing
View Details
Recombinant Human HER3/ErbB3 Protein (His Tag)
PKSH031766-01 50 µg

Recombinant Human HER3/ErbB3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HER3/ErbB3 Protein (His Tag)
PKSH031766-02 500 µg

Recombinant Human HER3/ErbB3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-20RA/IL-20R1 Protein (His Tag)
PKSH031633 100 µg

Recombinant Human IL-20RA/IL-20R1 Protein (His Tag)

Sign In for Pricing
View Details