Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Peptide - C-terminal region

Tcea1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116288

UniProt

Q4KLL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea1 Rabbit Polyclonal Antibody (orb576861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020906

Preservative

Lyophilized powder

AA Sequence

TAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASZ1 antibody
FNab00653 100 µg

ASZ1 antibody

Sign In for Pricing
View Details
1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid
266864-01 250 mg

1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid
266864-02 500 mg

1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid
266864-03 1 g

1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid
266864-04 2 g

1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid
266864-05 5 g

1- (4-Bromophenyl) -5-methyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details