Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Peptide - N-terminal region

TWF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A6RP, A6r, MSTP011, PTK9L

UniProt

Q6IBS0

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TWF2 Rabbit Polyclonal Antibody (orb581666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009215

Preservative

Lyophilized powder

AA Sequence

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Washc1 Mouse Gene Knockout Kit (CRISPR)
KN519316 1 Kit

Washc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRPC4 / TRP4 Mouse Monoclonal Antibody [Clone ID: N77/15]
75-119 100 µL

TRPC4 / TRP4 Mouse Monoclonal Antibody [Clone ID: N77/15]

Sign In for Pricing
View Details
Mouse CXCL16 Recombinant Rabbit monoclonal Antibody
HA723941B 100 µL

Mouse CXCL16 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CEP63 (NM_001042400) Human Over-expression Lysate
LY420878 100 µg

CEP63 (NM_001042400) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccl2 Mouse Gene Knockout Kit (CRISPR)
KN302782 1 Kit

Ccl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMCC Mouse Monoclonal Antibody [6-F6]
M1510-4 100 µL

SMCC Mouse Monoclonal Antibody [6-F6]

Sign In for Pricing
View Details