Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Peptide - C-terminal region

TFPT Peptide - C-terminal region

Product Specifications

Product Name Alternative

FB1, INO80F, amida

UniProt

P0C1Z6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPT Rabbit Polyclonal Antibody (orb586159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037474

Preservative

Lyophilized powder

AA Sequence

DDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Helix pomatia Lectin (Edible Snail) -HPA-
BA-3601-1 1 mg

Biotin Conjugated Helix pomatia Lectin (Edible Snail) -HPA-

Sign In for Pricing
View Details
GTF2H1 (NM_001142307) Human Over-expression Lysate
LY428028 100 µg

GTF2H1 (NM_001142307) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (Fc Tag)
PKSH033562-01 10 µg

Recombinant Human CD155/PVR/NECL5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD155/PVR/NECL5 Protein (Fc Tag)
PKSH033562-02 50 µg

Recombinant Human CD155/PVR/NECL5 Protein (Fc Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS703320 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
GFAP Recombinant Mouse monoclonal Antibody
HA610225 100 µg

GFAP Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details