Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR84 Peptide - C-terminal region

GPR84 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EX33, GPCR4

UniProt

Q9NQS5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR84 Rabbit Polyclonal Antibody (orb586315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065103

Preservative

Lyophilized powder

AA Sequence

ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), 0.2mg/mL
BNUB0525-100 1x 100 µL

CD63 (MX-49.129.5), 0.2mg/mL

Sign In for Pricing
View Details
BTN1A1 (NM_001732) Human Recombinant Protein
TP720427L 500 µg

BTN1A1 (NM_001732) Human Recombinant Protein

Sign In for Pricing
View Details
FCGRT Human Gene Knockout Kit (CRISPR)
KN200364 1 Kit

FCGRT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LOC129026 Human qPCR Primer Pair (NM_080842)
HP216770 200 Reactions

LOC129026 Human qPCR Primer Pair (NM_080842)

Sign In for Pricing
View Details
Recombinant Bcl2 Monoclonal Antibody
E-AB-81425-01 50 µL

Recombinant Bcl2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Bcl2 Monoclonal Antibody
E-AB-81425-02 100 µL

Recombinant Bcl2 Monoclonal Antibody

Sign In for Pricing
View Details