Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cxxc1 Peptide - N-terminal region

Cxxc1 Peptide - N-terminal region

Product Specifications

UniProt

A1A5S2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cxxc1 Rabbit Polyclonal Antibody (orb578880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073166

Preservative

Lyophilized powder

AA Sequence

HGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRERDGSERDGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ASD3 (MYH6) activation kit by CRISPRa
GA103066 1 Kit

Human ASD3 (MYH6) activation kit by CRISPRa

Sign In for Pricing
View Details
BIBW 2992
SIH-496-25MG 25 mg

BIBW 2992

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rTP53/1739), 0.2mg/mL
BNUB2091-500 1x 500 µL

P53 Tumor Suppressor Protein (rTP53/1739), 0.2mg/mL

Sign In for Pricing
View Details
Diosmin Octaacetate
TRC-D485205-500MG 500 mg

Diosmin Octaacetate

Sign In for Pricing
View Details
2-Hexylidenecyclopentanone
TRC-H296550-500MG 500 mg

2-Hexylidenecyclopentanone

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS509503 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details