Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLNC Peptide - N-terminal region

FLNC Peptide - N-terminal region

Product Specifications

Product Name Alternative

ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2

UniProt

Q14315

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLNC Rabbit Polyclonal Antibody (orb326498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001120959

Preservative

Lyophilized powder

AA Sequence

VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECW1 Antibody
KC-3748-01 50 μL

HECW1 Antibody

Sign In for Pricing
View Details
HECW1 Antibody
KC-3748-02 100 µL

HECW1 Antibody

Sign In for Pricing
View Details
HECW1 Antibody
KC-3748-03 1 mL

HECW1 Antibody

Sign In for Pricing
View Details
Stx8 Mouse Gene Knockout Kit (CRISPR)
KN516935 1 Kit

Stx8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FES (NM_001143785) Human Over-expression Lysate
LC428346 20 µg

FES (NM_001143785) Human Over-expression Lysate

Sign In for Pricing
View Details
Calretinin Recombinant Rabbit Monoclonal Antibody [JM12-93]
ET1705-19 100 µL

Calretinin Recombinant Rabbit Monoclonal Antibody [JM12-93]

Sign In for Pricing
View Details