Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Peptide - N-terminal region

ANGPTL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2

UniProt

O95841

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGPTL1 Rabbit Polyclonal Antibody (orb586011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004664

Preservative

Lyophilized powder

AA Sequence

KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r9 CRISPR/Cas9 KO Plasmid (m)
sc-436721 20 µg

Vmn2r9 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Olr1470 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV665398 1.0 µg DNA

Olr1470 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PKM Protein (N-His, Mouse)
P527626 100 µg

PKM Protein (N-His, Mouse)

Sign In for Pricing
View Details
PTPRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1758606 1.0 µg DNA

PTPRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fibrinogen gamma chain (FGG) Mouse Monoclonal Antibody [Clone ID: LBI4B8]
AMM14169VCF 100 µg

Fibrinogen gamma chain (FGG) Mouse Monoclonal Antibody [Clone ID: LBI4B8]

Sign In for Pricing
View Details
MIRacle™ hsa-miR-1261 miRNA Agomir/Antagomir
AM0568 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-1261 miRNA Agomir/Antagomir

Sign In for Pricing
View Details