Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CC2D2A Peptide - N-terminal region

CC2D2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

JBTS9, KIAA1345, MKS6

UniProt

E7EP21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CC2D2A Rabbit Polyclonal Antibody (orb326553) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065836

Preservative

Lyophilized powder

AA Sequence

EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT1A10 Rabbit Polyclonal Antibody
TA365120 100 µL

UGT1A10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FKBP52 Recombinant Rabbit Monoclonal Antibody [JG96-30]
ET7108-93 100 µL

FKBP52 Recombinant Rabbit Monoclonal Antibody [JG96-30]

Sign In for Pricing
View Details
KLF12 Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF810315 100 µg

KLF12 Mouse Monoclonal Antibody [Clone ID: OTI3D4]

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), Biotin conjugate, 0.1mg/mL
BNCB2431-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XPD Recombinant Rabbit Monoclonal Antibody [JE55-02]
ET7110-93 100 µL

XPD Recombinant Rabbit Monoclonal Antibody [JE55-02]

Sign In for Pricing
View Details
FITC Anti-Human CD39 Antibody[A1]
E-AB-F1165C-01 20 Tests

FITC Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details