Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK2 Peptide - C-terminal region

GALK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GK2, MGC1745

UniProt

Q01415

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK2 Rabbit Polyclonal Antibody (orb586476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002035

Preservative

Lyophilized powder

AA Sequence

TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEPD1 rabbit pAb
UB-GEN-7884 100 µL

EEPD1 rabbit pAb

Sign In for Pricing
View Details
PDCD6 Protein Vector (Human) (pPM-C-His)
PV030456 500 ng

PDCD6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal UBA52 Antibody (OTI4F2) [HRP]
NBP2-74730H 0.1 mL

Mouse Monoclonal UBA52 Antibody (OTI4F2) [HRP]

Sign In for Pricing
View Details
PSMD7 (NM_002811) Human Recombinant Protein
TP303133 20 µg

PSMD7 (NM_002811) Human Recombinant Protein

Sign In for Pricing
View Details
OCIAD1 Protein Vector (Human) (pPM-C-His)
PV029388 500 ng

OCIAD1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal ADAM17 (R215-Y433) Antibody (Human, Mouse, Rat)
B2020564 100 µg/Vial

Rabbit Polyclonal ADAM17 (R215-Y433) Antibody (Human, Mouse, Rat)

Sign In for Pricing
View Details