Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFRL Peptide - N-terminal region

PDGFRL Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDGRL, PRLTS

UniProt

Q15198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDGFRL Rabbit Polyclonal Antibody (orb586448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006198

Preservative

Lyophilized powder

AA Sequence

KVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LST1 Protein Lysate (Mouse) with C-HA Tag
27760034 100 µg

LST1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TSLP Recombinant Protein (Human)
OPCA05406-20UG 20 µg

TSLP Recombinant Protein (Human)

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS8522470-01 0.1 mg

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS8522470-02 0.1 mL (AF635)

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS8522470-03 0.1 mL (AF610)

EGFR Polyclonal Antibody

Sign In for Pricing
View Details
EGFR Polyclonal Antibody
MBS8522470-04 0.1 mL (AF405S)

EGFR Polyclonal Antibody

Sign In for Pricing
View Details