Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thymic stromal lymphopoietin

Gene Aliases

Thymic stromal lymphopoietin.

Gene ID

85480

Accession Number

NP_149024

Reactivity

Homo sapiens|Human

Target

Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c (+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Type

Protein

Source

Mammalian Cells

Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TSLP

Protein Name

Thymic stromal lymphopoietin

Gene Name URL

TSLP

Nucleotide Accession Number

NM_033035

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tauro-(25S)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oic Acid-d4 Sodium Salt
TRC-T009172-25MG 25 mg

Tauro-(25S)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oic Acid-d4 Sodium Salt

Sign In for Pricing
View Details
Influenza A H6N2 (A/chicken/Guangdong/C273/2011) Hemagglutinin / HA Protein (His Tag)
E45O54597I2-100 100 µg

Influenza A H6N2 (A/chicken/Guangdong/C273/2011) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
Lentiviral mouse Ppig shRNA (UAS) - Lentiviral mouse Ppig shRNA (UAS, GFP) plasmid
GTR15165226 1 Vial

Lentiviral mouse Ppig shRNA (UAS) - Lentiviral mouse Ppig shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RplO Antibody
orb826586 2 mg

RplO Antibody

Sign In for Pricing
View Details
SOX18 Conjugated Antibody
C37249 100 µL

SOX18 Conjugated Antibody

Sign In for Pricing
View Details
RGS6/7 (B-10)
sc-398222 200 µg/mL

RGS6/7 (B-10)

Sign In for Pricing
View Details