Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG10 Peptide - middle region

ALG10 Peptide - middle region

Product Specifications

Product Name Alternative

DIE2, FLJ14751, KCR1

UniProt

Q5BKT4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG10 Rabbit Polyclonal Antibody (orb586527) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116223

Preservative

Lyophilized powder

AA Sequence

AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12511061 1.0 µg DNA

ASB18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TipOne RPT 1250 uL XL ultra low retention graduated pipette tips, 40 racks of 96 tips (3840 tips) .Non-sterile.
1161-1860 3840 Tips

TipOne RPT 1250 uL XL ultra low retention graduated pipette tips, 40 racks of 96 tips (3840 tips) .Non-sterile.

Sign In for Pricing
View Details
Heat Shock Protein 70 (HSP70)
H1830-95T1 2x50ug

Heat Shock Protein 70 (HSP70)

Sign In for Pricing
View Details
Mer/c-Met-IN-1
HY-178438 1 Each

Mer/c-Met-IN-1

Sign In for Pricing
View Details
DDX24 polyclonal antibody
BS76333-01 50 µL

DDX24 polyclonal antibody

Sign In for Pricing
View Details
DDX24 polyclonal antibody
BS76333-02 100 µL

DDX24 polyclonal antibody

Sign In for Pricing
View Details