Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS1R2 Peptide - C-terminal region

TAS1R2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR71, T1R2, TR2

UniProt

Q8TE23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS1R2 Rabbit Polyclonal Antibody (orb586204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689418

Preservative

Lyophilized powder

AA Sequence

ISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf169 Polyclonal Antibody
RD217743A-01 20 µL

C14orf169 Polyclonal Antibody

Sign In for Pricing
View Details
C14orf169 Polyclonal Antibody
RD217743A-02 60 μL

C14orf169 Polyclonal Antibody

Sign In for Pricing
View Details
C14orf169 Polyclonal Antibody
RD217743A-03 120 μL

C14orf169 Polyclonal Antibody

Sign In for Pricing
View Details
C14orf169 Polyclonal Antibody
RD217743A-04 200 µL

C14orf169 Polyclonal Antibody

Sign In for Pricing
View Details
SAMD3 (NM_001017373) Human Over-expression Lysate
LC422767 20 µg

SAMD3 (NM_001017373) Human Over-expression Lysate

Sign In for Pricing
View Details
APC/CY7-Linked Monoclonal Antibody to Interleukin 6 (IL6)
MBS2037113-01 0.1 mL

APC/CY7-Linked Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details