Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYCO1 Peptide - N-terminal region

FYCO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp779K1152, FLJ13335, MGC126517, MGC126519, RUFY3, ZFYVE7

UniProt

Q9BQS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYCO1 Rabbit Polyclonal Antibody (orb586436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078789

Preservative

Lyophilized powder

AA Sequence

PLAQELEATRDSLDKKNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Navigator® Live Cell RNA Imaging Kit *Green Fluorescence*
22630-AAT 100 Tests

Cell Navigator® Live Cell RNA Imaging Kit *Green Fluorescence*

Sign In for Pricing
View Details
EAAC1 Antibody
SMC-406D 100 µg

EAAC1 Antibody

Sign In for Pricing
View Details
PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI5H6]
CF808125 100 µg

PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI5H6]

Sign In for Pricing
View Details
2,3,5-Tri-O-benzyl-D-ribono-1,4-lactone
TRC-T771378-5G 5 g

2,3,5-Tri-O-benzyl-D-ribono-1,4-lactone

Sign In for Pricing
View Details
Recombinant Human BACE1 protein (His tag)
PDEH100850-01 20 µg

Recombinant Human BACE1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human BACE1 protein (His tag)
PDEH100850-02 100 µg

Recombinant Human BACE1 protein (His tag)

Sign In for Pricing
View Details