Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl2l2 Peptide - C-terminal region

Bcl2l2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW048834, Bcl-w, Gtrgal2, Gtrosa41, bclw, c98

UniProt

P70345

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl2l2 Rabbit Polyclonal Antibody (orb573640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031563

Preservative

Lyophilized powder

AA Sequence

VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ligase Ligand-linker Conjugate 181
HY-173563 1 Each

E3 Ligase Ligand-linker Conjugate 181

Sign In for Pricing
View Details
Sf3a3-set siRNA/shRNA/RNAi Lentivector (Mouse)
43564094 4x 500 ng

Sf3a3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
FGF17 Rabbit Polyclonal Antibody (BF647)
orb2408797 100 µL

FGF17 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Rabbit Polyclonal RanBP3 Antibody [Alexa Fluor 750]
NBP2-97450AF750 0.1 mL

Rabbit Polyclonal RanBP3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein MAM3 (MAM3) , partial
MBS7073856 Inquire

Recombinant Saccharomyces cerevisiae Protein MAM3 (MAM3) , partial

Sign In for Pricing
View Details
Mouse Osteocyte Cell Complete Medium
CM-M217-01 100 mL

Mouse Osteocyte Cell Complete Medium

Sign In for Pricing
View Details