Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCK Peptide - C-terminal region

HCK Peptide - C-terminal region

Product Specifications

Product Name Alternative

JTK9, p59Hck, p61Hck

UniProt

P08631

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCK Rabbit Polyclonal Antibody (orb584947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001165602

Preservative

Lyophilized powder

AA Sequence

LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnl1 AAV siRNA Pooled Vector
22335164 1.0 µg

Gnl1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA)
orb2908045-01 20 µg

Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA)

Sign In for Pricing
View Details
Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA)
orb2908045-02 100 µg

Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA)

Sign In for Pricing
View Details
MBIP Antibody - C-terminal region
ARP82300_P050-25UL 25 µL

MBIP Antibody - C-terminal region

Sign In for Pricing
View Details
PI3 Kinase p85 beta Rabbit mAb
MBS4762521-01 0.1 mL

PI3 Kinase p85 beta Rabbit mAb

Sign In for Pricing
View Details
PI3 Kinase p85 beta Rabbit mAb
MBS4762521-02 5x 0.1 mL

PI3 Kinase p85 beta Rabbit mAb

Sign In for Pricing
View Details