Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Aquifex aeolicus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

O67292

Expression Region

1-259

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRITQGERESSGEFLMSREFYGVLIGVTTLLVIFLPKSLFLLVILFLCFAISREVSVALG ENEVFYFSPLVLLTYYFADPLVFPLIGLLSLYFAYKRWELNSFFKSTFLLFYPALFLVYL IKIKEISTYYLLIFIFGIWINDVFAYYIGKNFGKTPLFPKISPKKTVEGFLGGVLFGSLF FALTLPYGILNSFLLGTFVLTVGVAGDYFKSFIKRQVGIKDFSNVFGEHGGFTDRFDALV FSAPVFYLIMCAGELNCKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-100 1x 100 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF640R conjugate, 0.1mg/mL
BNC400818-500 1x 500 µL

CD45RA (PTPRC/818), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF568 conjugate, 0.1mg/mL
BNC682308-500 1x 500 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details