Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCK2 Peptide - middle region

ADCK2 Peptide - middle region

Product Specifications

Product Name Alternative

AARF, MGC20727

UniProt

Q7Z695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCK2 Rabbit Polyclonal Antibody (orb585542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_443085

Preservative

Lyophilized powder

AA Sequence

LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r117 CRISPR Activation Plasmid (m)
sc-437115-ACT 20 µg

Vmn1r117 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
187-1, N-WASP inhibitor (TFA)
HY-P1045A 1 Each

187-1, N-WASP inhibitor (TFA)

Sign In for Pricing
View Details
NDNF Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-19060R-BF350 100 µL

NDNF Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rat IgG1 unconjuagted (isotype control)
20005-11 100 µg

Rat IgG1 unconjuagted (isotype control)

Sign In for Pricing
View Details
Human LRP4 / Low-Density Lipoprotein Receptor-Related Protein 4 Recombinant Protein
MBS2902162 Inquire

Human LRP4 / Low-Density Lipoprotein Receptor-Related Protein 4 Recombinant Protein

Sign In for Pricing
View Details
Monoclonal Antibody to Chemokine C-C-Motif Receptor 4 (CCR4)
TRV-0060799-01 20 µL

Monoclonal Antibody to Chemokine C-C-Motif Receptor 4 (CCR4)

Sign In for Pricing
View Details