Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP1GAP2 Peptide - N-terminal region

RAP1GAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686O238, GARNL4, KIAA1039, RAP1GA3

UniProt

Q684P5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAP1GAP2 Rabbit Polyclonal Antibody (orb586638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055900

Preservative

Lyophilized powder

AA Sequence

MLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal LYAG/GAA Antibody
H00002548-B01P 0.05 mg

Mouse Polyclonal LYAG/GAA Antibody

Sign In for Pricing
View Details
TTBK1 (B-6)
sc-374600 200 µg/mL

TTBK1 (B-6)

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody (FITC)
orb2099709 100 µL

WDR77 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Prealbumin (TTR, ATTR, Transthyretin, TBPA, PALB) (Biotin)
131760-Biotin 100 µL

Prealbumin (TTR, ATTR, Transthyretin, TBPA, PALB) (Biotin)

Sign In for Pricing
View Details
Recombinant human KCTD11 protein
ATGP1983-250 250 µg

Recombinant human KCTD11 protein

Sign In for Pricing
View Details
Muscle Actin Rabbit pAb
ATL1019-01 30 µL

Muscle Actin Rabbit pAb

Sign In for Pricing
View Details