Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP12 Peptide - C-terminal region

RRP12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp762P1116, FLJ20231, KIAA0690

UniProt

Q5JTH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRP12 Rabbit Polyclonal Antibody (orb586643) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055994

Preservative

Lyophilized powder

AA Sequence

AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd54 Mouse Gene Knockout Kit (CRISPR)
KN501299 1 Kit

Ankrd54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
G CSF (CSF3) Rabbit Monoclonal Antibody
TA423055 100 µL

G CSF (CSF3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DEDD Human Gene Knockout Kit (CRISPR)
KN400590 1 Kit

DEDD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Picropodophyllotoxin
SIH-467-5MG 5 mg

Picropodophyllotoxin

Sign In for Pricing
View Details
MITF (NM_000248) Human Over-expression Lysate
LC424990 20 µg

MITF (NM_000248) Human Over-expression Lysate

Sign In for Pricing
View Details
Copb1 Mouse Gene Knockout Kit (CRISPR)
KN503676 1 Kit

Copb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details