Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACYP1 Peptide - middle region

ACYP1 Peptide - middle region

Product Specifications

Product Name Alternative

ACYPE

UniProt

P07311

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACYP1 Rabbit Polyclonal Antibody (orb331363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001098

Preservative

Lyophilized powder

AA Sequence

LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARSH activation kit by CRISPRa
GA117654 1 Kit

Human ARSH activation kit by CRISPRa

Sign In for Pricing
View Details
Ethylene Terephthalate Cyclic Dimer
TRC-E918170-1MG 1 mg

Ethylene Terephthalate Cyclic Dimer

Sign In for Pricing
View Details
Recombinant Human CDCP1/CD318 Protein (aa 30-341, His Tag)
PKSH033302-01 10 µg

Recombinant Human CDCP1/CD318 Protein (aa 30-341, His Tag)

Sign In for Pricing
View Details
Recombinant Human CDCP1/CD318 Protein (aa 30-341, His Tag)
PKSH033302-02 50 µg

Recombinant Human CDCP1/CD318 Protein (aa 30-341, His Tag)

Sign In for Pricing
View Details
PAGE1 Antibody
KC-26893-01 50 μL

PAGE1 Antibody

Sign In for Pricing
View Details
PAGE1 Antibody
KC-26893-02 100 µL

PAGE1 Antibody

Sign In for Pricing
View Details