GPRIN2 Peptide - N-terminal region
GPRIN2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GRIN2, KIAA0514, MGC15171
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPRIN2 Rabbit Polyclonal Antibody (orb586685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055511
Preservative
Lyophilized powder
AA Sequence
LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683293-500 1x 500 µL
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
