Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Brorin/VWC2, Human (HEK293, His)

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Brorin/VWC2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/brorin-vwc2-protein-human-hek293-his.html

Purity

97.00

Smiles

SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM

Molecular Formula

375567 (Gene_ID) Q2TAL6 (S28-M325) (Accession)

Molecular Weight

Approximately 44 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF770 shRNA Plasmid (h)
sc-90282-SH 20 µg

ZNF770 shRNA Plasmid (h)

Sign In for Pricing
View Details
Anti-Phospho-JAK3 (Tyr981) Polyclonal Antibody
TMAC-02277-01 50 μL

Anti-Phospho-JAK3 (Tyr981) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-JAK3 (Tyr981) Polyclonal Antibody
TMAC-02277-02 100 µL

Anti-Phospho-JAK3 (Tyr981) Polyclonal Antibody

Sign In for Pricing
View Details
KYNU Antibody - C-terminal region : HRP (ARP46037_P050-HRP)
ARP46037_P050-HRP 100 µL

KYNU Antibody - C-terminal region : HRP (ARP46037_P050-HRP)

Sign In for Pricing
View Details
Vmn2r10 Double Nickase Plasmid (m2)
sc-423643-NIC-2 20 µg

Vmn2r10 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
NAPA AAV Vector (Mouse) (CMV)
31450104 1 µg

NAPA AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details