Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSGEPL1 Peptide - C-terminal region

OSGEPL1 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OSGEPL1 Rabbit Polyclonal Antibody (orb586874) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071748

Preservative

Lyophilized powder

AA Sequence

IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant eGFP protein
CD02418 10 µg

Recombinant eGFP protein

Sign In for Pricing
View Details
SPARC Protein Lysate
OCOA13778-20UG 20 µg

SPARC Protein Lysate

Sign In for Pricing
View Details
Lestaurtinib
C12836 5 mg

Lestaurtinib

Sign In for Pricing
View Details
DFNA5 Protein Vector (Human) (pPB-C-His)
PV051333 500 ng

DFNA5 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Insulin Receptor, alpha (IRa) (BSA & Azide Free) (MaxLight 490) discontinued
I7661-25HX-ML490 100 µL

Insulin Receptor, alpha (IRa) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details
AGTPBP1 Double Nickase Plasmid (m2)
sc-426475-NIC-2 20 µg

AGTPBP1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details