Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBPL Peptide - C-terminal region

NUBPL Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf127, IND1, huInd1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUBPL Rabbit Polyclonal Antibody (orb586865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079428

Preservative

Lyophilized powder

AA Sequence

AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Limb Expression 1 (LIX1) Antibody (Biotin)
abx308977-01 20 µg

Protein Limb Expression 1 (LIX1) Antibody (Biotin)

Sign In for Pricing
View Details
Protein Limb Expression 1 (LIX1) Antibody (Biotin)
abx308977-02 50 µg

Protein Limb Expression 1 (LIX1) Antibody (Biotin)

Sign In for Pricing
View Details
Protein Limb Expression 1 (LIX1) Antibody (Biotin)
abx308977-03 100 µg

Protein Limb Expression 1 (LIX1) Antibody (Biotin)

Sign In for Pricing
View Details
Protein Limb Expression 1 (LIX1) Antibody (Biotin)
abx308977-04 200 µg

Protein Limb Expression 1 (LIX1) Antibody (Biotin)

Sign In for Pricing
View Details
Protein Limb Expression 1 (LIX1) Antibody (Biotin)
abx308977-05 1 mg

Protein Limb Expression 1 (LIX1) Antibody (Biotin)

Sign In for Pricing
View Details
Donkey anti Mouse IgG (H + L) (HRP)
43R-ID042HRP 0.5 mL

Donkey anti Mouse IgG (H + L) (HRP)

Sign In for Pricing
View Details