Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VWC2 Peptide - middle region

VWC2 Peptide - middle region

Product Specifications

Product Name Alternative

PSST739, UNQ739

UniProt

Q2TAL6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VWC2 Rabbit Polyclonal Antibody (orb586908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940972

Preservative

Lyophilized powder

AA Sequence

YVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chemerin
100-395S 5 µg

Chemerin

Sign In for Pricing
View Details
Rat Hp1bp3 ELISA Kit
EF018806 96 Tests

Rat Hp1bp3 ELISA Kit

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF594 conjugate, 0.1mg/mL
BNC941386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLEC10A Protein Vector (Mouse) (pPM-C-HA)
PV166060 500 ng

CLEC10A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CDK1 Antibody
OAEE00348-100UG 0.1 mg (C100)

CDK1 Antibody

Sign In for Pricing
View Details
Fxn sgRNA CRISPR Lentivector (Rat) (Target 2)
K6703003 1.0 µg DNA

Fxn sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details