Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEH Peptide - C-terminal region

POTEH Peptide - C-terminal region

Product Specifications

Product Name Alternative

A26C3, ACTBL1, CT104.7, POTE22

UniProt

Q6S545

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POTEH Rabbit Polyclonal Antibody (orb587053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129685

Preservative

Lyophilized powder

AA Sequence

EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DCXR Antibody [FITC]
NBP3-00319F 0.1 mL

Rabbit Polyclonal DCXR Antibody [FITC]

Sign In for Pricing
View Details
C14orf43 Antibody - C-terminal region (ARP68115_P050)
ARP68115_P050 100 µL

C14orf43 Antibody - C-terminal region (ARP68115_P050)

Sign In for Pricing
View Details
CFPAC-1
ABC-TC0133 1 Vial

CFPAC-1

Sign In for Pricing
View Details
DNTP pre-mixes, 10 mM aqueous solution
ND46295 1 mL

DNTP pre-mixes, 10 mM aqueous solution

Sign In for Pricing
View Details
DDIT3, CT (A135) (DDIT3, CHOP, CHOP10, GADD153, DNA damage-inducible transcript 3 protein, C/EBP-homologous protein, C/EBP-homologous protein 10, Growth arrest and DNA damage-inducible protein GADD153) (MaxLight 490) discontinued
034534-ML490 100 µL

DDIT3, CT (A135) (DDIT3, CHOP, CHOP10, GADD153, DNA damage-inducible transcript 3 protein, C/EBP-homologous protein, C/EBP-homologous protein 10, Growth arrest and DNA damage-inducible protein GADD153) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)
orb2910529-01 20 µg

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

Sign In for Pricing
View Details