Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q6LWZ4

Expression Region

1-299

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG EPVSYGLYVAVAGTIAWALINAGLNVVLAIIVGAGVAAIVHGAYSVSAFLGRTVGQSKKF GQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFPLPLVSLIFGITVGAIGS STGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCF GLIIFLDGWRSILGNIIGGDLVTKTSIALLVGLLVVAVAAVINRKLEVYARNKYGPYRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
MBS9422729-01 0.02 mg

Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
MBS9422729-02 0.1 mg

Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
MBS9422729-03 1 mg

Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial
MBS9422729-04 5x 1 mg

Recombinant Schizosaccharomyces pombe Sulfide:quinone oxidoreductase, mitochondrial

Sign In for Pricing
View Details
CNOT8, NT (CNOT8, CALIF, POP2, CCR4-NOT transcription complex subunit 8, CAF1-like protein, CAF2, CCR4-associated factor 8) (MaxLight 405)
MBS6287311-01 0.1 mL

CNOT8, NT (CNOT8, CALIF, POP2, CCR4-NOT transcription complex subunit 8, CAF1-like protein, CAF2, CCR4-associated factor 8) (MaxLight 405)

Sign In for Pricing
View Details
CNOT8, NT (CNOT8, CALIF, POP2, CCR4-NOT transcription complex subunit 8, CAF1-like protein, CAF2, CCR4-associated factor 8) (MaxLight 405)
MBS6287311-02 5x 0.1 mL

CNOT8, NT (CNOT8, CALIF, POP2, CCR4-NOT transcription complex subunit 8, CAF1-like protein, CAF2, CCR4-associated factor 8) (MaxLight 405)

Sign In for Pricing
View Details