Ppp3cb Peptide - middle region
Ppp3cb Peptide - middle region
Product Specifications
Product Name Alternative
Calna2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppp3cb Rabbit Polyclonal Antibody (orb583595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
P20651
Preservative
Lyophilized powder
AA Sequence
MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
More Discoveries
Explore Other Products
Browse additional items from our catalog
ELI-05450h 96 Tests
Human Matrix metalloproteinase-16, MMP16 ELISA KIT
Sign In for Pricing
View Details 
MBS1051138-01 0.02 mg (E-Coli)
Recombinant Hypnea musciformis Lectin-1
Sign In for Pricing
View Details MBS1051138-02 0.1 mg (E-Coli)
Recombinant Hypnea musciformis Lectin-1
Sign In for Pricing
View Details