Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAGHL Peptide - C-terminal region

HAGHL Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAGHL Rabbit Polyclonal Antibody (orb587023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

Q6PII5

Preservative

Lyophilized powder

AA Sequence

PVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Src Adenovirus (Ad-CMV-Src)
1166 200 µL

Src Adenovirus (Ad-CMV-Src)

Sign In for Pricing
View Details
E-Syt2 shRNA Plasmid (h)
sc-89470-SH 20 µg

E-Syt2 shRNA Plasmid (h)

Sign In for Pricing
View Details
LPPR3 Antibody
42-317 0.1 mg

LPPR3 Antibody

Sign In for Pricing
View Details
FBXO42 (NM_018994) Human Tagged ORF Clone Lentiviral Particle
RC209600L4V 200 µL

FBXO42 (NM_018994) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POU2F1 Recombinant Protein
OPCD05891-10UG 10 µg

POU2F1 Recombinant Protein

Sign In for Pricing
View Details
Human Monoclonal CXCL4/PF4 Antibody (U.Penn. patent anti-PF4) [Allophycocyanin]
NBP3-27973APC 0.1 mL

Human Monoclonal CXCL4/PF4 Antibody (U.Penn. patent anti-PF4) [Allophycocyanin]

Sign In for Pricing
View Details