Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MACROD1 Peptide - N-terminal region

MACROD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LRP16

UniProt

Q9BQ69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MACROD1 Rabbit Polyclonal Antibody (orb587060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054786

Preservative

Lyophilized powder

AA Sequence

MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Transcription Factor Dp Family Member 3 (TFDP3) ELISA Kit
MBS9914221 Inquire

Duck Transcription Factor Dp Family Member 3 (TFDP3) ELISA Kit

Sign In for Pricing
View Details
SIRP gamma, Cynomolgus (HEK293, His)
HY-P77489-01 5 µg

SIRP gamma, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
SIRP gamma, Cynomolgus (HEK293, His)
HY-P77489-02 10 µg

SIRP gamma, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
SIRP gamma, Cynomolgus (HEK293, His)
HY-P77489-03 50 µg

SIRP gamma, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
SIRP gamma, Cynomolgus (HEK293, His)
HY-P77489-04 100 µg

SIRP gamma, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
Human Coiled coil domain containing protein KIAA1407 (KIAA1407) ELISA kit
GTR10407755 96 Well

Human Coiled coil domain containing protein KIAA1407 (KIAA1407) ELISA kit

Sign In for Pricing
View Details