Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC25 Peptide - C-terminal region

TTC25 Peptide - C-terminal region

Product Specifications

UniProt

Q96NG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC25 Rabbit Polyclonal Antibody (orb326820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113609

Preservative

Lyophilized powder

AA Sequence

RLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF769/RB associated KRAB repressor Rabbit Polyclonal Antibody (APC)
orb1000991 100 µL

ZNF769/RB associated KRAB repressor Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
anti-FARSLA
YF-PA11720 50 ul

anti-FARSLA

Sign In for Pricing
View Details
Cdkn2aipnl AAV siRNA Pooled Vector
15731166 1.0 µg

Cdkn2aipnl AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)
orb2931297-01 20 µg

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)
orb2931297-02 100 µg

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Sign In for Pricing
View Details
FITC anti-mouse Ly-6G
GT03354 500 µg

FITC anti-mouse Ly-6G

Sign In for Pricing
View Details