Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)
This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8) spans the amino acid sequence from region 29-186.
Product Specifications
Product Name Alternative
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial, Complex I-ASHI, CI-ASHI, NADH-ubiquinone oxidoreductase ASHI subunit
UniProt
Q0MQE6
Expression Region
29-186
Origin
Gorilla gorilla gorilla (Lowland gorilla)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPISWHVMCMQLFGFLAFMIFMCWVGD VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 