Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp445 Peptide - middle region

Zfp445 Peptide - middle region

Product Specifications

Product Name Alternative

AW610627, ZNF168, Znf445, mszf29, mszf50

UniProt

Q8R2V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp445 Rabbit Polyclonal Antibody (orb324717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775540

Preservative

Lyophilized powder

AA Sequence

NFRKSSHHYNNKYGEGLRGTGEGFGVYQNTGLKENGKDRYGETSRKSWHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF6 (NM_145027) Human Recombinant Protein
TP314978L 1 mg

KIF6 (NM_145027) Human Recombinant Protein

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL
BNC403644-500 1x 500 µL

CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-01 10 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-02 50 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
Replacement Cartridge for Label Printers
L9010-12ULT 1 Each

Replacement Cartridge for Label Printers

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562153 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details